Doodle

1,830 Coloring Pages of Pollinator

plantsflowerspollinator-friendlyperennialanimalsgardenswildflowerinsectsmeadowtropical
Bee from Cartoon animals coloring book
Lavender from Plants ii coloring book
American Redstart Birds and Honeycomb from Animals
Chrysanthemum 3 from Perennial
Dendrobium Nobile Orchid from Orchid
Chrysanthemum 4 from Perennial
Solidago or Goldenrod from Goldenrod
Duchesse de Brabant Rose Bush from Roses
Charisma Yellow Red Floribunda Rose from Roses
Golden Showers Climbing Rose from Roses
Orchid Lycaste Aromatica from Orchid
Delphinium Trolliifolium or Columbian Larkspur from Larkspur
Iris Motif from Iris
Iris Flower Blossom from Iris
Epigaea Repens or Mayflower or Trailing Arbutus from Leaves
Black Elderberry from Elderberry
Disa Kewensis Orchid from Orchid
Pollinators of Alaska from Nps
Double Delight Hybrid Tea Rose from Roses
Chrysanthemum 1 from Perennial
Bee from Cartoon animals viii coloring book
Black Raspberry from Celebrating wildflowers coloring book
Common Fruit Bats from Realistic animals coloring book
Spring Crocus from Crocus
Heliconia Indica from Heliconia
Butterfly from Cartoon animals vii coloring book
Bug from Animals
Cherokee Rose from Roses
Chinese Peony from Flowers
Hibiscus Flower from Hawaii flower
Hibiscus from Realistic flowers
Bumblebee from Woodland animals
Butterfly from Cartoon animals viii coloring book
Annual Hibiscus (Abelmoschus Moschatus) from Hawaii flower
Apple Blossom Branch from Apple tree
Steampunk Bee from Steampunk animals coloring book
Fireweed or Rosebay Willowherb from Celebrating wildflowers coloring book
Cosmos Scabiosoides from Cosmos
Swallow Tail Hummingbird from Hummingbirds
Bee from Cartoon animals v coloring book
Daffodil from Daffodil
Ladybug from Cartoon animals coloring book
Butterfly from Cartoon animals coloring book
American Twinflower from Celebrating wildflowers coloring book
Realistic Sunflowers from Sunflower
Realistic Ruby Throated Hummingbird from Hummingbirds
Bumblebee from Bumblebee
Ladybug from Cartoon animals v coloring book
Ladybug from Cartoon animals viii coloring book
Daisy from Simple objects iv coloring book
Bumblebee from Simple objects coloring book
Daffodil Flowers from Daffodil
Clarkia Amoena Farewell to Spring from Godetia
Aquilegia Truncata Red Columbine from Columbine
Cirsium Vulgare or Bull Thistle from Thistle
Dianthus Caryophyllus Clove Pink Carnation from Carnation
Cochlospermum Vitifolium or Buttercup Tree from Buttercup
Viola Adunca or Pale Mountain Violet from Violet
Schlumbergera Bloom from Cactus
Oriental poppy from Perennial
Hummingbird from Cartoon animals ii coloring book
Grasshopper on the Flower from Grasshoppers
Renanthera Imschootiana Orchid from Orchid
Saskatoon from Serviceberry
Masdevallia Coccinea Orchid from Orchid
Hyacinth Flower from Hyacinthus
Rabbit Smelling Tulip from Grass
Common Evening Primrose or Evening Star from Primrose
Tropical Vanda Tricolor Orchid from Orchid
Grasshopper on Flower from Grasshoppers
ʻIʻiwi - Hawaiian Honeycreeper from Hawaii
Aster 1 from Asters
Sophronitis Cernua Orchid from Orchid
Sundowner Rosa Grandiflora from Roses
Cornflower from Cornflowers
Grasshopper in Garden from Grasshoppers
Black Locust from Locust tree
Giant Red Indian Paintbrush from Celebrating wildflowers coloring book
Hiker's Gentian Or Explorer's Gentian from Celebrating wildflowers coloring book
Big-Headed Clover from Celebrating wildflowers coloring book
Yellow Edged Giant Owl Butterfly from Butterfly
Blooming Sunflower from Sunflower
Life Cycle of Monarch Butterfly from Biology
Pink Hibiscus from Realistic flowers
Anemone Coronaria from Anemone
Chrysanthemum Morifolium from Flower garden
Daffodil from Daffodil
Chrysanthemum Carinatum from Realistic flowers
Aster or Star Plant from Asters
Chinese Bellflower (Platycodon Grandiflorus) from Bellflower
Tall Mountain Bluebells from Celebrating wildflowers coloring book
Burke's Larkspur from Celebrating wildflowers coloring book
Bluebell Bellflower from Bellflower
Cute Butterfly Flies over the Swamp from Cute butterflies coloring book
Heliconia Psittacorum from Heliconia
Scarlet Carnation from Carnation
Ranunculus Acris from Buttercup
Cornflower, Blue Bottle from Cornflowers
Butterfly Flies On A Flower from Flowers
Western Blue Flax from Celebrating wildflowers coloring book
201 - 300 of 1,830 Next page
/ 19